www.facebook.com ... The Standard Model of Particle Physics (Chapter 5): Electrons, Protons And Neutrons. --- Please SUBSCRIBE to Science & Reason: • www.youtube.com • www.youtube.com • www.youtube.com --- STANDARD MODEL OF PARTICLE PHYSICS: www.youtube.com 1) First Second Of The Universe: www.youtube.com 2) Force And Matter: www.youtube.com 3) Quarks: www.youtube.com 4) Gluons: www.youtube.com 5) Electrons, Protons And Neutrons: www.youtube.com 6) Photons, Gravitons & Weak Bosons: www.youtube.com 7) Neutrinos: www.youtube.com 8) The Higgs Boson / The Higgs Mechanism: www.youtube.com The Standard Model of particle physics is a theory of three of the four known fundamental interactions and the elementary particles that take part in these interactions. These particles make up all visible matter in the universe. Every high energy physics experiment carried out since the mid-20th century has eventually yielded findings consistent with the Standard Model. Still, the Standard Model falls short of being a complete theory of fundamental interactions because it does not include gravitation, dark matter, or dark energy. It is not quite a complete description of leptons either, because it does not describe nonzero neutrino masses, although simple natural extensions do. • en.wikipedia.org --- ELECTRONS The particle itself is a fundamental particle and is too small to be seen by any imaginable instrument of observation. So we instead represent the properties that allow the electron to ... Теги:standardmodelofparticlephysicsfundamentalforcesmatterenergytheoryelementaryparticlesatomsprotonsneutronselectronsuniverseneutrinosmassesupdownquarksphotonsgluonsstrongforcemasselectricweakchargefieldpropertiesnuclearelectromagneticflavoursradioactivedecaymagneticfieldscomplexityfluxtubegravitonsbosonshiggs
Take a closer look at the gargantuan density of a neutron star as it drifts through space with BBC science show 'Death Star'. Scientists explian the potential effect an explosion from a neutron star within our galaxy would have on Earth. Теги:BBCSpaceScienceDeathStarExplosionDeepUniverseGalaxyAwesomeHotFreeVideo
Armed with state-of-the-art supercomputer models, scientists have shown that colliding neutron stars can produce the energetic jet required for a gamma-ray burst. Earlier simulations demonstrated that mergers could make black holes. Others had shown that the high-speed particle jets needed to make a gamma-ray burst would continue if placed in the swirling wreckage of a recent merger. Now, the simulations reveal the middle step of the process--how the merging stars' magnetic field organizes itself into outwardly directed components capable of forming a jet. The Damiana supercomputer at Germany's Max Planck Institute for Gravitational Physics needed six weeks to reveal the details of a process that unfolds in just 35 thousandths of a second--less than the blink of an eye. This video is public domain and can be downloaded at: svs.gsfc.nasa.gov Like our videos? Subscribe to NASA's Goddard Shorts HD podcast: svs.gsfc.nasa.gov Or find NASA Goddard Space Flight Center on facebook: www.facebook.com Or find us on Twitter: twitter.com Теги:NASAastrophysicsneutron starsimulationblack holegamma ray burstSwiftScott Wiessinger
Neutron stars are created when a massive star runs out of fuel and collapses. As the star collapses, the density becomes so immense that protons and electrons are squeezed tightly together to form neutrons. The end result is a star only 20 km across but weighing 1 1/2 times more than our sun and made up mostly of neutrons. Теги:NeutronStarsChandraX-rayAstronomy
Song: Neutron Dance By: The Pointer Sisters Album: Break Out The picture is from google. I don't own anything. enjoy... :) Теги:neutrondancepointersistersbreakoutpopr&bmv
Video Clip of the most dangerous man in the universe according to Monty Python (honestly) Shades of current Conflicts involving the US Military. thanks Monty Python Team filmed at Lingfeild Station Surrey (Full version availible on line on DVD) Теги:ParodySketch