disclaimer: The Ark Hotel Video is copyright free. Please feel free to use it for any purpose. visit: www.broad.com for more information Level 9 Earthquake Resistance: diagonal bracing structure, light weight, steel construction, passed level 9 earthquake resistance testing 6x Less Material: even though the construction materials are much lighter(250kg/m2) than the traditional materials(over 1500kg/m2), the floors and walls are solid with surefootedness, airtight and sound-proofing 5x Energy Efficient: 150mm thermal insulation for walls and roofs, triple glazed plastic windows, external solar shading, heat insulation, fresh air heat recovery, LED lighting, yearly HAVC A/C energy consumption equivalent to 7 liters oil. 20x Purification: after 3 levels of purification, the purification efficiency for fresh air reaches 95%-99.9%; air exchanged 1-2.5 times per hour, and indoor air is 20x cleaner than out door air 1% Construction Waste: all components are factory made, construction waste, mainly package materials, result from on site set-up only and amount to 1% of the total weight of the building. This is the first building in human history which combines almost all environmental friendly, comfortable and secure elements. So, we call it: Sustainable Building Теги:hoteltime lapseeco designconstructionsustainabilitysustainablepassive solarinsulationbuildingenergyefficiencymodularbroadarchitecturespeedsafetyprefabfabricationsteel
Follow Facebook: www.facebook.com Follow Twitter: twitter.com Follow Google+: plus.google.com Press/licensing/projects contact: tsophotography@gmail.com If you can not watch, or want higher quality watch: vimeo.com This was filmed between 4th and 11th April 2011. I had the pleasure of visiting El Teide. Spain´s highest mountain @(3718m) is one of the best places in the world to photograph the stars and is also the location of Teide Observatories, considered to be one of the world´s best observatories. The goal was to capture the beautiful Milky Way galaxy along with one of the most amazing mountains I know El Teide. I have to say this was one of the most exhausting trips I have done. There was a lot of hiking at high altitudes and probably less than 10 hours of sleep in total for the whole week. Having been here 10-11 times before I had a long list of must-see locations I wanted to capture for this movie, but I am still not 100% used to carrying around so much gear required for time-lapse movies. A large sandstorm hit the Sahara Desert on the 9th April and at approx 3am in the night the sandstorm hit me, making it nearly impossible to see the sky with my own eyes. Interestingly enough my camera was set for a 5 hour sequence of the milky way during this time and I was sure my whole scene was ruined. To my surprise, my camera had managed to capture the sandstorm which was backlit by Grand Canary Island making it look like golden clouds. The Milky Way was shining through the ... Теги:spainelteidemountainlandscapenaturetime-lapsetimelapsecolorskysunsetthemountaintheterjesørgjerdterjesørgjerdtsotesotsophotographytesophotographytenerifeelteidemilkywaymilkywaystarsastroel teideterje sørgjerdtso photographyteso photographythe mountain
The biggest build FyreUK have ever done - A Huge Custom Designed Build : The Great City of Aquila. Aquila is Latin for Eagle. A Harbor, Industrial District, Huge Restidential Area, Castle and Underground Enclave - all together in one massive build. DOWNLOAD Aquila City: dl.laxwashere.com It will appear as 'The Syndicate Epic Seed' ingame once you have put it in your .minecraft/saves folder. dl.laxwashere.com ----------------------------------------------------- Built with love - for you guys! This build was created for TheSyndicateProject for his Minecraft Series - www.youtube.com Enjoy and remember to comment, rate and Subscibe! Dokucraft Texture pack: www.minecraftcustomizer.net Intro Music by: NubbyCakums - www.newgrounds.com Music by Approaching Nirvana: www.youtube.com Song 1: No Strings Attached (Edit) Get the song on iTunes: bit.ly Song 2: Keeping Quiet Get the song on iTunes: bit.ly Song 3: Running Get the song on iTunes: bit.ly Song 4: A Swedish Hau5 Party Get the song on iTunes: bit.ly Support Approaching Nirvana - www.kickstarter.com All music has been used with the correct usage rights discussed on the Approaching Nirvana channel - info found in this video: www.youtube.com Теги:MinecraftMinecraft TimelapseTimelapseTimeLapseThe Great City of AquilaAquila TimelapseBuildingCityTownCity TimelapseTimelapsingMassivethesyndicateprojectSyndicateHugecameramovementcoolnicefreshepicscalebridgeBuildcastlewaterfalllavalakesidevoxelsnipervoxelMegaAwesomeNotchMojangMineCraftfiredragon04FYREUKFyreMattMatthewPhilbrutealmightyamazingdaynightlandharborundergroundthrone
