The Khrizantema (Russian: "Хризантема"; English: Chrysanthemum) is a Russian anti-tank missile. Khrizantema was designed to deal with current and future generations of main battle tanks, such as the M1A2 and Leopard 2 and can also be used to engage slow and low flying aerial targets like helicopters[1]. The missile carries the GRAU designation 9M123 and the NATO reporting name AT-15 Springer The Khrizantema anti-tank missile was first unveiled in July 1996 by the Konstruktorskoye Byuro Mashynostroyenia (KBM) Engineering Design Bureau[2]. The missile had started development in the 1980s and was designed as an all weather, multi-purpose missile system that could defeat current and future armoured units equipped with advanced armour protection like explosive reactive armour (ERA). Khrizantema was invisaged as a replacement for a variety of different types of anti-tank missile that remained in service with the Soviet military, such as the 9K114 Shturm and the 9M120 Ataka-V. The system entered service with the Russian armed forces in 2004 The 9M123 missile itself is supersonic, flying at an average speed of 400 m/s or Mach 1.2 [3] and a range of between 400 and 6000 meters[3]. Propulsion is by way of a single solid fuel rocket motor with two exhausts on either side of the missile. The off-set exhausts cause the missile to spin during flight with guidance control provided by two pop-out control surfaces at the rear of the missile (four additional surfaces help stabilise the ... Теги:TankKillerHunterPanzerjaegerХризантемаVoennoeDelolaserguidedsystembattleartillerymilitarynakedAT-15Springer
Lyrics here Valery Leontiev Valeriy Leontyev Валерий Леонтьев "Nine Chrysanthemums" Спасибо, фанклуб "Дельтаплан" за это видео Ты прости, что опять я не прав видно был, А потом я букет хризантем подарил... Но на те цветы не взглянула ты! Сгоряча от тебя я уйти поспешил... Припев: А, впрочем, нету никаких проблем, Кроме этих хризантем, Кроме белых опоздавших хризантем. Ты слышишь, нету никаких проблем, И нам уже легко совсем, И нету больше общих тем... Лишь девять хризантем... Взять такси и скорее умчать на вокзал... Сколько раз этот способ меня выручал! Но еще пока ты мне так близка, И билет я на поезд еще не достал... Припев: А, впрочем, нету никаких проблем, Кроме этих хризантем, Кроме белых опоздавших хризантем. Ты слышишь, нету никаких проблем, И нам уже легко совсем, И нету больше общих тем... Лишь девять хризантем... Closed captioning is now available for this video (click "cc" for simultaneous translation). Forgive me! It seems that I was wrong, again! Later, I brought you a bouquet of chrysanthemums... But you did not even look at my flowers! Offended, I rushed to leave you. Chorus: Yet, you know... There are no real problems between us, except those chrysanthemums... I brought you these white chrysanthemums too late... Do you hear me? There are no problems between us! We have already cooled down... There are no more issues between us, except those chrysanthemums! To take a taxi and rush to a train station? I did it so many times before! Yet, you are still very ... Теги:ValeriyLeontievValeryLeontyevВалерийЛеонтьевДевять хризантемRussian musicRussian singerlive musiclive concertlyricstranslationclosed captioningRussian superstarrussiasongperformancefull
DVD: www.amazon.com thefilmarchive.org My Favorite Brunette is a 1947 movie spoofing movie detectives and the film noir style. Starring Bob Hope and Dorothy Lamour, it also features Lon Chaney, Jr. playing Willie, a character based on his Of Mice and Men role Lennie; Peter Lorre as Kismit, a comic take on his many film noir roles; and cameo appearances by film noir regular Alan Ladd and Hope partner Bing Crosby. The movie is now in the public domain and most copies of it available today are of poor quality. The film was later featured in an episode of Cinema Insomnia. The story is told in flashback from Death Row as Ronnie Jackson (Hope) relates the events to a group of reporters the events that lead to his predicament. Jackson is a baby photographer who dreams about being a real private detective like his friend Sam McCloud (Ladd). One day he is mistaken for a detective by a mysterious lady in distress (Lamour) and soon finds himself involved in a murder mystery. Featured cast Actor / Role Bob Hope / Ronnie Jackson Alan Ladd / Sam McCloud Dorothy Lamour / Baroness Carlotta Montay Frank Puglia / Baron Montay Peter Lorre / Kismet Lon Chaney, Jr. / Willie John Hoyt / Dr. Lundau Charles Dingle / Major Simon Montague Reginald Denny / James Collins Ann Doran / Miss Rogers Sir Bob Hope, KBE, KCSG, KSS (born Leslie Townes Hope; May 29, 1903 -- July 27, 2003) was a British-born American comedian and actor who appeared in vaudeville, on Broadway, and in radio, television and ... Теги:beautymurderdeathrowphotographerbabychasephotographysanquentinpenitentiarynarrativedetectiveagencybeautifulwomanprisonsanitariummistakenidentityflashbackframeupcomedyromancemysteryfilmshortselfgabrieldramaactiontrailerindependentcinemathrillerjimmysilentstudentmightynoirdocumentaryfeaturewendysuspenselivedefensedirectorpicworld warhistoryrussia
This is a video shot on 1 Jan 2010 of Pete's Station in Central Kansas. The highlight is the massive 28 foot 1.2 GHz Dish mounted on the navy Gunturrent. The echo demonstration off the moon, both on CW and Voice was amazing. Can't wait to see what Pete puts up on the other new towers he installed on the site this fall. Теги:MoonbounceStationPeteCentralKansas
TВ пeрeдача "ударная сила" oб истoрии разрабoтак прoтивo-танкoвoй ракeты "фагoт" "кoнкурс" . The 9M111 Fagot (Russian: 9М111 «Фагот»; English: bassoon) is a SACLOS wire-guided anti-tank missile of the Soviet Union. "9M111" is the GRAU designation of the missile. Its NATO reporting name is AT-4 Spigot. The 9M113 Konkurs (Russian: 9М113 «Конкурс»; English: contest) SACLOS wire-guided Anti-tank missile of the Soviet Union. "9M113" is the GRAU designation of the missile. Its NATO reporting name is AT-5 Spandrel. Теги:прoтивoтанкаваяракeтакoнкурсфагoтanti-tankmissileSpigotRussiaweaponsconkurs
EPIC ENDING OF A JEDI!!! This video is a testing record of a game called Jedi Academy... Let me put a story to this vid. This is the epic story of a Being so powerful that without him every jedi and sith did not exist. The energy of the entire universe came from him, he created it a quintillion lightyears ago and discovered a path to imortality by his creation. He gave this 2 choosen lifeforms a tiny amount of his power the Sith and the Jedi. Over time, he wandered and observed the behavior of the 2 lifeforms in search of his understanding of the universe and on why did he exist himself. He traveled the universe serching for answers, as the time past and conflict emerge from 2 lifeforms many war fought and many bloodshed. The supreme being did not understand what's happening between the 2 lifeforms. The supreme being wondered that if the conflict continues between the two forces, the war may devour other lower lifeforms in there galaxy. To prevent those from happening, the Supream being sent a very powerful avatar of himself to their galaxy to settle things up, unfortunately the final judgement of the supreme being pointed the mistake to the sith. The Jedi's accept the supreme being's decision to end the war but the Sith refuses, resulting for the supreme being's personification to kill all the sith he encounters. Now the sith will feel the wrath of the avatar... Теги:jediacademystarwarssithobamashowbizlucasfilmconquestofparadisedisturbedliberatediemotherfuckerdopeenemyduelsfatevangelisassasinavatarChicksWithGunstarantinoquentinjackiebrownat-15schoolrumblelovehinamaihimekhrizantemarussianmilitarydefencemissiletankarmywariraqsexscandal